PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family G2-like
Protein Properties Length: 378aa    MW: 42469.3 Da    PI: 8.8741
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010265genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like58.31.6e-18255292138
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkv 38 
                k+r++W++eLH+rFv+a++qLGGs++AtPk+i+elm+ 
  Cla010265 255 KQRRCWSKELHRRFVSALQQLGGSQVATPKQIRELMQK 292
                79**********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-7252298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-14253295IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-14255293IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGSLPSELSL DFRPTFVPKT ITDFFKEVSM IGNVSERVSK LNDFIKSLED EMRKIDAFKR  60
ELPLCMILLK DAILAVKEES MQCAVPKTQP VLEEFIPLKK ERDEEDDDDF KKGKDYRDQK  120
NWMSSVQLWN SDTDYTYDRK RDSKLETKIK EKGGPVVTQV SLQSCRNKNG ERIHMPFKPS  180
YPMFPSAMAV RKEDKEEFPI HGLSLCTPGI KNPMEESAST GSRSSATRAV SSSTLTASVN  240
LRTGMQQQKQ QCSRKQRRCW SKELHRRFVS ALQQLGGSQV ATPKQIRELM QKFRLHARRL  300
PASAVASANQ SVVVLGGLVV PQDPYANSSK ACSSQSGSPQ GPLQLAGTGG DSMEDDDDVK  360
SENYCWKSRI QKPGNEDA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819141e-157LN681914.1 Cucumis melo genomic scaffold, anchoredscaffold00050.
GenBankLN7132651e-157LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649201.10.0PREDICTED: uncharacterized protein LOC101214647
TrEMBLA0A0A0LIJ10.0A0A0A0LIJ1_CUCSA; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-29G2-like family protein